PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g043250.2
Common NameMTR_2g043250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 1115aa    MW: 124370 Da    PI: 6.4045
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g043250.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B370.62.1e-22126227199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++
  Medtr2g043250.2 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldfsM-QPPA-QEIVAKDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI--RD 215
                      99*****************************954.4444.48************************************************..55 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      ++++l++++ r+
  Medtr2g043250.2 216 EKQQLLLGIKRS 227
                      788789988775 PP

2Auxin_resp121.56.2e-40252334183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaas++s+F+++YnPr+s+ eFv++++k++kal+++vs+GmRf+m+feteds  rr++Gt++g+sdldpvrW+nS+Wr+L+
  Medtr2g043250.2 252 AAHAASNNSPFTIFYNPRTSPCEFVIPLAKYNKALYTHVSLGMRFRMMFETEDSGVRRYMGTITGISDLDPVRWKNSQWRNLQ 334
                      79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.26E-43116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.6E-41118241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.10E-19125217No hitNo description
SMARTSM010197.9E-23126228IPR003340B3 DNA binding domain
PfamPF023621.3E-20126227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.167126228IPR003340B3 DNA binding domain
PfamPF065077.1E-35252334IPR010525Auxin response factor
PfamPF023091.8E-89831072IPR033389AUX/IAA domain
PROSITE profilePS5174523.1099861070IPR000270PB1 domain
SuperFamilySSF542772.09E-79991064No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1115 aa     Download sequence    Send to blast
MKAPSNGYLA NSGEGERKAI NSELWHACAG PLVSIPPVGS LVVYFPQGHS EQVAASMQKE  60
ADIIPSYPNL PSKLICMLHN VALHADPETD EVYAQMTLQP VNKYDKEAML ASDMGLKQNQ  120
QPSEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDFSMQ PPAQEIVAKD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKQQL LLGIKRSSRQ QPALSSSVIS  240
SDSMHIGILA AAAHAASNNS PFTIFYNPRT SPCEFVIPLA KYNKALYTHV SLGMRFRMMF  300
ETEDSGVRRY MGTITGISDL DPVRWKNSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PKFPKQPGMP EDESEIENAF KRAMPWLGDE LGMKDTSSSV FPGLSLVQWM  420
SMQQNNNQFS AAQSGLLPPS MLSSNAMHGN LNTDDPSKIL NFQSPAALSA PSLQFNKPNL  480
PNQVNQLQQP PASWSQQQQQ QQKMQSLLPM PLNQLQQQQQ RQQQLAGSQN LPQPQQQQPQ  540
LTQQSPQQPQ QQQQHQQPCQ NTTMNNGTIG SNQIPNQCVQ QPVTYSQLQQ QLLSGSMQSQ  600
QNLQSAGKNG LMMTSLPQDS QFQQQIDQQQ AGLLQRQQQQ NQLQQSSLQL LQQSMLQRGP  660
QQPQMSQTVP QNISDQQQQL QLLQKLQQQQ QQQQQQQPLS TSSQLLQSQL LPQQSQQMPQ  720
QPMSQHQPQQ LGNNAFSMEK LLNNNYSSSP LMHPQQLPVN HLQNTQKSPT NTRAPSAFTD  780
GDAPSCSTSP STNNCQTSPP NPLKRNQPDT FGGPSMVETT NNLMQELQSK SDMQSKHELH  840
GVKGPDKQKH KGAINDHMEA SSGTSYGIDP GNIHQNFPLS NFYMDGDVHS QQPRSNIPFA  900
SNLDGLTPDP LLSRGYDSQK DLQNLLSNYG GAPRDIETEL STADISSQSF GVPNMSFKPG  960
CSNEIPIADT GVLNNGLWSN QNQRMRTYTK VQKCGSVGRC IDVTRYKGYE ELRNDLARMF  1020
GIEGQLEDPV RVDWKLVYVD HENDILLVGD DPWEEFVNCV QSIKILSSAE VQQMSLEGDL  1080
GYNIPITNQA CSGSESGNAW RAQYDDNSAA SFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1691535545388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.257560.0root
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013463581.10.0auxin response factor 2
TrEMBLA0A072V7K30.0A0A072V7K3_MEDTR; Auxin response factor
STRINGGLYMA09G08350.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]